Sign In | Join Free | My fustat.com
fustat.com
Products
Search by Category
Home > Chemicals > Alkene >

Injectable Peptides Bodybuilding

injectable peptides bodybuilding

All injectable peptides bodybuilding wholesalers & injectable peptides bodybuilding manufacturers come from members. We doesn't provide injectable peptides bodybuilding products or service, please contact them directly and verify their companies info carefully.

Total 8184 products from injectable peptides bodybuilding Manufactures & Suppliers
Wholesale Mechano Growth Factor Bodybuilding Injectable Peptide Mgf 2Mg / vial from china suppliers

Brand Name:HKB

Model Number:62031-54-3

Place of Origin:China

Mechano Growth Factor Bodybuilding Injectable Peptide Mgf 2Mg / vial Cas No:62031-54-3 Unit Size :2 mg/vial HPLC purity:98% SDS-PAGE purity:98%. Synonyms: MGF, Mechano Growth Factor, IGF-1Ec Molecular Formula : C121H200N42O39 Molecular Weight :2948.15 Sequence :PEG-Suc-Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-D-Arg-D-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-His-Lys-NH2 Appearance :White Powder Source :Chemical Synthesis Storage :Lyophilized Peg MGF is stable at room temperature for 90 days...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Wholesale 98% Human Growth Peptides AICAR 2627-69-2 Powder For Bodybuilding from china suppliers

Brand Name:Yuancheng

Model Number:2627-69-2

Place of Origin:Wuhan,Hubei

98% AICAR Raw Peptide AICAR CAS2627-69-2 Powder for Body-building CAS:2627-69-2 Purity:98% Appearance:white powder M.W.:258.231 M.F.:C9H14N4O5 Packing:10g/foil bag AICAR Storage: Before reconstitution (lyophilized / freeze dried powder): Can be stored in the refrigerator (2°C to 8°C = 35°F to 47°F) for 36 months. Can be stored at room Temperature (up to 37°C = 99°F) for 90 days. After reconstitution (liquid): Can be stored in the refrigerator (2°C to 8°C = 35°F to 47°F) for 5 days. AIRCAR, also

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Wholesale CAS 863288-34-0 Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding from china suppliers

Brand Name:BestSteroid

Model Number:863288-34-0

Place of Origin:Hubei,China

Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding CJC-1295 Basic Info Sequence H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 Molecular Formula C152H252N44O42 One Letter Sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 Physical Apperance white powder Form & Formulations Sterile Filtered white lyophilized (freeze-dried) Stability 2 months at room temperature 24 months from date of receipt, 20 °C as ...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Wholesale Follistatin 315 1mg For Fat Burning / Injectable Peptides Bodybuilding from china suppliers

Brand Name:Sendi

Model Number:Pharmaceutical Grade

Place of Origin:China

Anti-aging White powder Growth Hormone Peptides Follistatin 315 For Fat Burning Quick detail Product Name Follistatin-344 Chemical Name Follistatin 344 CAS Number 80449-31-6 Molecular Formula C13H16O3 Molecular Weight 751.9 N-terminal Sequence Gly30 specification 1mg/vail / 2mg/vail Assay 99.5% Appearance White powder Follistatin-344 Description Additional scientific study that has been conducted on animal test subjects has also determined that Follistatin 344 acts as an antagonist to myostatin;

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Wholesale 98% Assay Medical Raw Steroid Powders Human Growth Peptides Peg Mgf 2mg / Vial from china suppliers

Brand Name:YIHAN

Model Number:PEG-MGF

Place of Origin:China

98% Assay Medical Raw Steroid Powders Human Growth Peptides Peg Mgf 2mg / Vial Pegylated Mechano Grow Factor Peptides Hormones Pegylated MGF PEG MGF Pegylated Mechano Grow Factor Peptides Hormones Product name PEG MGF Other name Pegylated Mechano Grow Factor, Pegylated MGF CAS number N/A sjgbolic Molecular formula C121H200N42O39 Molecular weight 2867.2 Assay( Puriy) Above 98% Usage PEG MGF(Pegylated Mechano Grow Factor) As Peptides Hormones Promote your body releases a pulse of an MGF splice ...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Wholesale Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF from china suppliers

Brand Name:kafen

Model Number:HGH-Eptifibatide

Place of Origin:Guangzhou,China

Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF 1 . Quick Detail 2mg*10vial/kit Molecular Formula : C121H200N42O39 Molecular Weight : 2867.2 CAS No. : N/A Sequence: Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln- Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-Arg-Lys-NH2 2 . Description PEGylation is the act of attaching a Polyethylene glycol (PEG) structure to another larger molecule (in this case, MGF). The PEG acts as a protective coating and the theory here is .

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Wholesale CAS 170851-70-4  Peptides Powder Bodybuilding  CJC-1295 With DAC ISO9001 Standard from china suppliers

Brand Name:Yuancheng

Model Number:170851-70-4

Place of Origin:China

CAS 170851-70-4 Injectable Peptides Bodybuilding Pharmaceutical CJC-1295 With DAC CAS: 170851-70-4 MF: C38H49N9O5 MW: 711.853 Assay: 99% Peptide Hormone 2mg/vial CJC-1295 with DAC Bodybuilding Supplements Quality testing: All the steroids only be shipped out before tested in university and lab here. Use Guidance: CJC-1295 is most suited to instances where an individual wishes to inject infrequently and is seeking substantive support for GH production rather than a maximum or near-maximum ...

Wuhan Yuancheng Technology Development Co., Ltd.
Verified Supplier

Hubei

Wholesale Melanotan II CAS 121062-08-6 for Sexual Dysfunction Treatment from china suppliers

Brand Name:YC

Model Number:CAS NO.: 121062-08-6

Place of Origin:China

Melanotan II CAS 121062-08-6 Injectable Peptides Bodybuilding For Sexual Dysfunction Treatment Quick Details: * Product name: Melanotan-II/ MT-2* Synonyms: melanotan; Melanotan-II; MT-II* CAS No.: 121062-08-6* Grade: Pharmaceutical Grade * Molecular Formula: C50H71N15O10* Molecular Weight: 1042.1932* Assay: 99%* Packing: 2mg/vial, quantity according to customer\'s detail requirements.* Melting point: 2℃* Boiling point: 225℃* Appearance: White crystalline powder. * Storage: Closed, below 2 ~ 8℃ .

Wuhan Yuancheng Technology Development Co., Ltd.
Verified Supplier

Hubei

Wholesale MT-1 Injectable HGH Peptides Bodybuilding   75921-69-6 Melanotan I from china suppliers

Brand Name:Steroid(Saichuang)

Model Number:99

Place of Origin:China

MT-1 Injectable HGH Peptides Bodybuilding 75921-69-6 Melanotan I MT-1 White Lyophilized Melanotan muscle gain steroids Peptide Powder MT 1 MT-1 White Lyophilized Peptide Hormone Powder Melanotan I Melanotan I Melanotan II GHRP-2 GHRP-6 CJC1295 DAC-CJC1295 MGF PEG-MGF fragment177-191 fragment 176-191AOD PT141 Sermorelin Hexarelin Ipamorelin EGF MT-1 Basic Info. MT 1 Model No.: Melanotan I 10mg/vial, 100vial/kit Melanotan Export Markets: Global Melanotan I Product Description Melanotan I : 75921..

Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
Verified Supplier

Hubei

Wholesale High Purity Muscle Building Peptides GHRP - 2 , Injectable Peptides Bodybuilding CAS 158861-67-7 from china suppliers

Brand Name:YUANYANG

Model Number:CAS: 158861-67-7

Place of Origin:CHINA

High Purity Peptide GHRP-2 (5 mg or 10 mg/vial) China Peptide Manufacturer Supply Basic Details: Product Name: GHRP-2 CAS: 158861-67-7 MF: C45H55N9O6 MW: 818.0 Density: 1.333g/cm3 Boiling Point: 1407°C at 760 mmHg Storage Temperature: 20°C Refractive index: 1.664 Purity (HPLC): 98.0%min. Appearance: White powder Single Impurity (HPLC): 1.0%max Amino Acid Composition: ±10% of theoretical Peptide Content (N%): ≥80.0% Water Content(Karl Fischer): ≤6.0% Acetate Content (HPIC): ≤12.0% Description: ..

Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Wholesale Injectable Muscle Building Peptides Bodybuilding CJC 1295 Without DAC 863288-34-0 from china suppliers

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

Injectable CJC 1295 Growth Hormone Peptide CJC 1295 Without DAC Weight Loss 1. CJC 1295 Information: Product name: CJC 1295 Appearance: White Lyophilized Powder Purity (HPLC): 99.19% Single Impurity(HPLC): 1.0% Amino Acid Composition: 10% of theoretical Peptide Content(N%): 80%(by %N) Water Content(Karl Fischer): 6.0% Acetate Content(HPIC): 15.0% MS(ESI): N/A Mass Balance: 95.0~105.0% Payment & Shipping Terms: Mini Order: 10 vials Price: Negotiable Packaging Details: Super discreet to ensure

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Wholesale PEG MGF Peptide Injections Bodybuilding PEGylated Mechano Growth Factor from china suppliers

Brand Name:BOF

Model Number:N/A

Place of Origin:China

PEG MGF Peptide Injections Bodybuilding PEGylated Mechano Growth Factor​ Basic View: 2mg*10vial/kit Molecular Formula : C121H200N42O39 Molecular Weight : 2867.2 CAS No. : N/A Sequence: Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln- Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-Arg-Lys-NH2 Brief Introduction: 1. PEG-MGF, or PEGylated Mechano Growth Factor is a new and innovative form of MGF that outperforms natural MGF many times over. MGF is a splice variant of the IGF gene which increases stem cell

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Wholesale Growth Hormone Peptides BPC-157 Injectable Vials Bodybuilding Steroids from china suppliers

Brand Name:Shanghai Stero

Model Number:BPC-157

Place of Origin:China

Growth Hormone Peptides BPC-157 Injectable Vials Bodybuilding Steroids What Does BPC-157 Do? BPC-157 surprisingly has no side effects, and it has been shown in a study to restore tendons, muscles, intestines, teeth, bones, etc. In in vivo studies for humans and rodents, as well as with oral or injectable subcutaneous or intramuscular injection . BPC-157 Was Shown 1, Stimulate the tendon and ligament healing as a result of the growth of tendons, cell survival and cell migration in the model of ..

Shanghai Stero R&D Co,. Ltd
Verified Supplier

Shanghai

Wholesale Ghrp-6 Acetate Injectable Peptides Bodybuilding Peptides For Muscle Building from china suppliers

Brand Name:Gear Steroids

Model Number:87616-84-0

Place of Origin:CHINA

Ghrp-6 Acetate Injectable Peptides Bodybuilding Peptides For Muscle Building 1, Basic Information Model NO.: 87616-84-0 Suitable for: Adult Purity: >98% Other Name: Ghrp-6 Acetate Function: for Weight Loss Storage: Keep Cold Form: White Frozen Dry Powder Type: Raw Material Transport Package: Vial Origin: Shanghai,China Powder: Yes Certification: GMP, SGS, ISO 9001, USP, BP Discount:Available For Big Quantity Product Name: Ghrp-6 CAS: 87616-84-0 Place of Origin: Shanghai Shelf Life: 2 Years ..

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

Wholesale Human Growth Peptides Bodybuilding Hormone Injection Selank Raw Powder from china suppliers

Brand Name:purity

Model Number:129954-34-3

Place of Origin:china

Human Growth Peptide Hormone Injection Selank Raw Powder for Bodybuilding Quick detail Chemical Name : Selank Selank CAS Number : 129954-34-3 Selank Molecular Formula : C33H57N11O9 Selank Molecular Weight 751.9 Selank specification: 2mg/vail / 10mg/vail Selank Assay : 99.5% Selank Appearance : White powder Selank Description Selank is a nootropic, anxiolytic peptide based drug developed by the Institute of Molecular Genetics of the Russian Academy of Sciences. Selank is a heptapeptide with the .

Zhuzhou Yuancheng Hezhong Technology Development Co., Ltd.
Verified Supplier

Hunan

Wholesale Human Growth Hormone Peptides Bodybuilding IGF - 1 LR3 Peptide Injection 946870-92-4 from china suppliers

Brand Name:Blue Dragon

Model Number:IGF-1 LR3 (1mg)

Place of Origin:China Manufacturer

95% IGF-1 LR3 1mg Growth Hormone Peptides 946870-92-4 LR3 IGF1 Human 1, IGF-1 LR3 (1mg) Introduction: Product name: IGF-1 LR3 Synonyms: R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, LONG R3IGF1, LONG R3 IGF-1, LONG R3IGF-1, LR3 IGF1 Human IGF-1 LR3 Specification: 1mg per vial IGF-1 LR3 CAS#: 946870-92-4 IGF-1 LR3 Physical Appearance: Sterile Filtered White Lyophilized (freeze-dried) Powder IGF-1 LR3 Source: Escherichia Coli IGF-1 LR3 Purity: Greater than 90.0% as ...

Zhuhaishi Shuangbojie Technology Co., Ltd.
Verified Supplier

Guangdong

Wholesale Gonadorelin Acetate Growth Hormone Peptides , Injectable Peptides for Bodybuilding Whiter Powder from china suppliers

Brand Name:Yvonne

Model Number:Lyophilized Powder In Vials / Pure Raw Powder No Vial

Place of Origin:China

Gonadorelin Acetate Growth Hormone Peptides , Injectable Peptides Bodybuilding Product Details: Product Name Gonadorelin Acetate Also known as Gonadorelin Appearance Freeze-Dried White Powder Standard Pharmaceutical Purity Not Lower Than 98.00% Application Type Injection Supplying Form Lyophilized Powder In Vials / Pure Raw Powder No Vial Custom Supported. ①. Various Colors of Flip off Caps ②. 2mg/vial , 5mg/vial, 10mg/vial , or no vials . ③. Peptides Blend According to Your Demand. such as CJC

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hubei

Wholesale Sample Muscle Mass Steroid Drostanolone enanthate ( CAS 472-61-145 ) with Domestic Shipping for Muscle Growth from china suppliers

Brand Name:LANDMARK

Model Number:HPLC verfied

Place of Origin:CHINA

Sample Muscle Mass Steroid Drostanolone enanthate ( CAS 472-61-145 ) with Domestic Shipping for Muscle Growth 1. Drostanolone Enanthate Alias: Drostanolone; Drolban; Masteron-E, Masteron Enanthate CAS NO.: 472-61-145 Molecular formula: C27H44O3 Molecular weight: 416.64 Characters: White powder . Melting point: 65℃—68℃ Half life: 8-10 days Detection time: 3months 2. Description Masteron Enanthate is the anabolic steroid that is slow acting, but is acts for longer period of time. In fact, Masteron

Landmark Nutraceuticals Co., Limited
Verified Supplier

Hongkong

Wholesale Injectable Peptides Bodybuilding , Fat Loss Peptides For Pharmaceutical Intermediates from china suppliers

Brand Name:DW

Model Number:87616-84-0

Place of Origin:China

Growth Hormone Peptides GHRP-6 CAS 87616-84-0 For Muscle Increasement Quick Details: Product Name:GHRP-6 (Growth Hormone Releasing Peptide 6) CAS: 87616-84-0 MF: C46H56N12O6 MW: 873.01 Purity (HPLC): 98.0%min. Appearance: White powder Usage: Pharmaceutical intermediates. COA: Product Name GHRP-2 Acetate Sequence Cas No. 158861-67-7 Molecular Formula C45H55N9O6 Molecular Weight 818.0 Purity (HPLC) 98.0%min. Appearance White powder Single Impurity (HPLC) 1.0%max Amino Acid Composition ±10% of ...

Doublewin Biological Technology Co., Ltd.
Verified Supplier

Guangxi

Wholesale Follistatin 315 1mg For Fat Burning / Injectable Peptides Bodybuilding from china suppliers

Brand Name:Sendi

Model Number:Pharmaceutical Grade

Place of Origin:China

...Anti-aging White powder Growth Hormone Peptides Follistatin 315 For Fat Burning Quick detail Product Name Follistatin-344 Chemical Name Follistatin 344 ...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Wholesale Ghrp-6 Acetate Injectable Peptides Bodybuilding Peptides For Muscle Building from china suppliers

Brand Name:Gear Steroids

Model Number:87616-84-0

Place of Origin:CHINA

...Ghrp-6 Acetate Injectable Peptides Bodybuilding Peptides For Muscle Building 1, Basic Information Model NO.: 87616-84-0 Suitable for: Adult Purity: >98% Other ...

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

Wholesale High Purity DNP Injectable Peptides Bodybuilding For Fat Burning CAS 51 - 28 - 5 from china suppliers

Brand Name:Biofriend

Model Number:51 - 28 - 5

Place of Origin:China

...High Purity DNP Injectable Peptides Bodybuilding For Fat Burning CAS 51 - 28 - 5 Muscle building Steroids Product Name:2, 4-Dinitrophenol Alias: DNP DNP ...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Wholesale High Purity DNP Injectable Peptides Bodybuilding For Fat Burning CAS 51 - 28 - 5 from china suppliers

Brand Name:Muscle Bodybuilding

Model Number:CAS 51-28-5

Place of Origin:China

...DNP 2, 4-Dinitrophenol Bodybuilding Prohormones CAS 51-28-5 For Fat Burning Product Name:2, 4-Dinitrophenol Alias: DNP DNP CAS No: ...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

Wholesale Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF from china suppliers

Brand Name:kafen

Model Number:HGH-Eptifibatide

Place of Origin:Guangzhou,China

...Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF 1 . Quick Detail 2mg*10vial/kit Molecular Formula : C121H200N42O39 Molecular ...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Wholesale Injectable Peptides Bodybuilding CJC-1295 With DAC 2mg/Vial For Increase GH from china suppliers

Brand Name:anabolic-oral steroids

Model Number:CJC1295

Place of Origin:China

...Injectable peptides Steroids CJC1295 / CJC-1295 with DAC 2mg/vial for Increase GH with Colorful Tops CJC-...

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Wholesale High Purity Muscle Building Peptides GHRP - 2 , Injectable Peptides Bodybuilding CAS 158861-67-7 from china suppliers

Brand Name:YUANYANG

Model Number:CAS: 158861-67-7

Place of Origin:CHINA

...High Purity Peptide GHRP-2 (5 mg or 10 mg/vial) China Peptide Manufacturer Supply Basic Details: Product Name: GHRP-2 CAS: 158861-67-7 MF: C45H55N9O6 MW: 818.0 Density: 1....

Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Wholesale Tesamorelin Fat Burning Peptides / 99% Purity Injectable Peptides Bodybuilding from china suppliers

Brand Name:nanjian

Model Number:2mg/Vial

Place of Origin:China

...99% Purity China lab Bodybuilding Peptide Tesamorelin Product Description Tesamorelin, 2mg/vial Sequence: C6H9O-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Wholesale Pharmaceutical TB500 Peptide Bodybuilding White Powder for Performance Enhancement from china suppliers

Brand Name:LSW

Model Number:TB500 Lyophilized Powder In Vials / Pure Raw Powder No Vial

Place of Origin:China TB500

...TB500 Peptide Bodybuilding TB -4 Fragment Thymosin Beta 4 Performance Enhancement Basic Info. Product Name TB-500 Also known as ...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hubei

Wholesale Injectable Peptide Hormones Ipamorelin 2mg/Vial for Muscle Growth Without Negative Side Effects170851-70-4 from china suppliers

Brand Name:wumeitech

Model Number:CAS 77591-33-4 Pure Lab Peptides Thymosin Beta 4 /Tb500/Tb-500 Basic Info Port:China Production Capacity:50000pieces/Year Payment Terms: T/T,Western Union, Money Gram Model NO.: 77591-33-4 Customized: Customized Suitable for: Adult Purity: >97% Appearanc

Place of Origin:China

...Injectable Peptide Hormones Ipamorelin 2mg/Vial for Muscle Growth Basic Info Min. Order:10 vials Port:hongkong ...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Wholesale HMG Human Menopausal Gonadotropin 75iu 99% Purity Injectable Peptides from china suppliers

Brand Name:Landmark

Model Number:Pharma Grade

Place of Origin:China

...Human Menopausal Gonadotropin HMG 75iu 99% purity Human Menopausal Gonadotropin, known as HMG, is an injectable peptide. Initially, HMG was invented in order to help women conceive. It is a fertility medication which...

Landmark Nutraceuticals Co., Limited
Verified Supplier

Hongkong

Wholesale Human Growth Peptides Bodybuilding Powder Hexarelin 140703-51-1 Suggestion Administration from china suppliers

Brand Name:Keray

Model Number:SHSC-02514

Place of Origin:China

...Growth Peptides Bodybuilding Powder Hexarelin 140703-51-1 Suggestion Administration Do you have any discounts if I place an order ? ...

Verified Supplier

Guangdong

Wholesale Releasing Hormones Peptides Powder CJC-1295(Dac) Injectable For Bodybuilding CAS: 863288-34-0 from china suppliers

Brand Name:HKYC

Model Number:muscle building

Place of Origin:HUBEI,CHINA

...Releasing Hormones Peptides Powder CJC-1295(Dac) Injectable For Bodybuilding CAS: 863288-34-0 Just try a small order to start our cooperation, we will NOT make ...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Wholesale Top Service Injectable Peptide Lyophilized Powder Tesamorelin 218949-48-5 for Bodybuilding from china suppliers

Brand Name:Pharmlab

Model Number:218949-48-5

Place of Origin:China

...Top Service Injectable Peptide Lyophilized Powder Tesamorelin 218949-48-5 for Bodybuilding Quick Details : CAS 218949-48-5 SYNONYMS Hex-hGRF, ThGRF(1-44), TH-9507, (Hexenoyl trans-3)-hGRF(1-...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Wholesale Sermorelin GHRH (1-29) 86168-78-7 Human Growth Peptides , growth peptides bodybuilding from china suppliers

Brand Name:ChineseHormone

Model Number:CAS:86168-78-7

Place of Origin:China

... powder Description: Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human...

Hengyang Desen Biotechnology Co., Ltd.
Verified Supplier

Hunan

Wholesale Healthy Peptides Bodybuilding Hormone Delta Sleep-inducing Peptide DSIP 2mg/vial from china suppliers

Brand Name:HKYC

Model Number:62568-57-4

Place of Origin:China

...#: 62568-57-4 Formula: C35H48N10O15 Molecular Weight: 848.81 Purity: 99.0%min 2. Description: Delta sleep-inducing peptide, abbreviated DSIP, is a neuropeptide that when infused into the mesodiencephalic ventricle of recipient rabbits induces...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Wholesale Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 from china suppliers

Brand Name:YIHAN

Model Number:IGF-1 LR3

Place of Origin:CHINA

...Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 Product information: Product name:GF-1Lr3 CAS No.:946870-...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Wholesale Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF from china suppliers

Brand Name:kafen

Model Number:HGH-Eptifibatide

Place of Origin:China

...Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF 1. Basic info. Product Name: MGF Synonyms: PEG MGF Sequence: ...

Guangzhou Kafen Biotech Co.,Ltd
Active Member

Guangdong

Wholesale Hexarelin Peptide White Powder Injectable Peptides Bodybuilding 140703-51-1 from china suppliers

Brand Name:Pharm

Model Number:hannah@chembj.com

Place of Origin:China

...Hexarelin Peptide White Powder Injectable Peptides Bodybuilding 140703-51-1 Hexarelin Product Name Hexarelin Sequence Cas No. 140703-51-1 Molecular Formula C47H58N12O6 Molecular ...

HUBEI PHARMAGRADE STEROIDS., LTD
Active Member

Hubei

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request